RAB3IP Rabbit Polyclonal Antibody

CAT#: TA337554

Rabbit Polyclonal Anti-RAB3IP Antibody

Product Images

WB Suggested Anti-RAB3IP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: NCI-H226 cell lysate

• 

  Application: Immunofluorescence; Species+tissue/cell type: Mouse retina tissue; Primary antibody dilution: 1: 200; Secondary antibody: Goat anti-rabbit Alexafluor 568; Secondary antibody dilution: 1: 200 - See more at: http: //www.avivasysbio.com/rab3ip-a

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB3IP antibody: synthetic peptide directed towards the N terminal of human RAB3IP. Synthetic peptide located within the following region: APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: RAB3A interacting protein
• Database Link:
  NP_783322
  Entrez Gene 216363 MouseEntrez Gene 117177 Human
  UniProt ID Q96QF0
• Background: The specific function of this protein remains unknown.
• Synonyms: RABIN3; RABIN8
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 85%; Mouse: 85%