RAB3IP Rabbit Polyclonal Antibody

CAT#: TA337554

Rabbit Polyclonal Anti-RAB3IP Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RAB3IP"

Specifications

Product Data
Applications IF, WB
Recommended Dilution WB, IF
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAB3IP antibody: synthetic peptide directed towards the N terminal of human RAB3IP. Synthetic peptide located within the following region: APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name RAB3A interacting protein
Background The specific function of this protein remains unknown.
Synonyms RABIN3; RABIN8
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 85%; Mouse: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.