AASDH Rabbit Polyclonal Antibody

CAT#: TA337591

Rabbit Polyclonal Anti-AASDH Antibody

Product Images

WB Suggested Anti-AASDH Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AASDH antibody: synthetic peptide directed towards the middle region of human AASDH. Synthetic peptide located within the following region: TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 122 kDa
• Gene Name: aminoadipate-semialdehyde dehydrogenase
• Database Link:
  NP_861522
  Entrez Gene 132949 Human
  UniProt ID Q4L235
• Background: Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.
• Synonyms: ACSF4; LYS2; NRPS998; NRPS1098
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: Lysine biosynthesis, Lysine degradation, Metabolic pathways