EIF5 Rabbit Polyclonal Antibody

CAT#: TA337602

Rabbit Polyclonal Anti-EIF5 Antibody

Product Images

WB Suggested Anti-EIF5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysateThere is BioGPS gene expression data showing that EIF5 is expressed in HeLa

• 

  Host: Rabbit; Target Name: EIF5; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml; There is BioGPS gene expression data showing that EIF5 is expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF5 antibody: synthetic peptide directed towards the N terminal of human EIF5. Synthetic peptide located within the following region: SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: eukaryotic translation initiation factor 5
• Database Link:
  NP_892116
  Entrez Gene 217869 MouseEntrez Gene 1983 Human
  UniProt ID P55010
• Background: EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).
• Synonyms: EIF-5; EIF-5A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%