LRRC56 Rabbit Polyclonal Antibody

CAT#: TA337606

Rabbit Polyclonal Anti-LRRC56 Antibody

Product Images

WB Suggested Anti-LRRC56 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRRC56 antibody: synthetic peptide directed towards the N terminal of human LRRC56. Synthetic peptide located within the following region: LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: leucine rich repeat containing 56
• Database Link:
  NP_932341
  Entrez Gene 115399 Human
  UniProt ID Q8IYG6
• Background: LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.
• Synonyms: DKFZp761L1518; FLJ00101
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Horse: 86%; Zebrafish: 85%