IL13 receptor alpha 2 (IL13RA2) Rabbit Polyclonal Antibody

CAT#: TA337646

Rabbit Polyclonal Anti-IL13RA2 Antibody

Product Images

WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

• 

  Sample Type: Lane 1: 60 ug mouse CT26 lysate Lane 2: 60 ug mouse MC38 lysate Lane 3: 60 ug human HCT116 lysate Lane 4: 60 ug mouse CT26 lysate + blocking peptide Lane 5: 60 ug mouse MC38 lysate + blocking peptide Lane 6: 60 ug human HCT116 lysate + blocki

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL13RA2 antibody: synthetic peptide directed towards the N terminal of human IL13RA2. Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: interleukin 13 receptor subunit alpha 2
• Database Link:
  NP_000631
  Entrez Gene 16165 MouseEntrez Gene 3598 Human
  UniProt ID Q14627
• Background: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
• Synonyms: CD213A2; CT19; IL-13R; IL13BP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Jak-STAT signaling pathway