Necdin (NDN) Rabbit Polyclonal Antibody

CAT#: TA337667

Rabbit Polyclonal Anti-NDN Antibody

Product Images

WB Suggested Anti-NDN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NDN antibody: synthetic peptide directed towards the middle region of human NDN. Synthetic peptide located within the following region: VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: necdin, MAGE family member
• Database Link:
  NP_002478
  Entrez Gene 4692 Human
  UniProt ID Q99608
• Background: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]
• Synonyms: HsT16328; PWCR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors