Prolyl Endopeptidase (PREP) Rabbit Polyclonal Antibody

CAT#: TA337694

Rabbit Polyclonal Anti-PREP Antibody

Product Images

PREP antibody - middle region (ARP56414_P050) validated by WB using neuroblastome, purified prep at 1:1000.

• 

  WB Suggested Anti-PREP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HT1080 cell lysatePREP is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PREP antibody: synthetic peptide directed towards the middle region of human PREP. Synthetic peptide located within the following region: LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: prolyl endopeptidase
• Database Link:
  NP_002717
  Entrez Gene 5550 Human
  UniProt ID P48147
• Background: The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. [provided by RefSeq, Jul 2008]
• Synonyms: PE; PEP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Protease