SPG3A (ATL1) Rabbit Polyclonal Antibody

CAT#: TA337733

Rabbit Polyclonal Anti-SPG3A Antibody

Product Images

Host: Rabbit; Target Name: SPG3A; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPG3A antibody is: synthetic peptide directed towards the C-terminal region of Human SPG3A. Synthetic peptide located within the following region: DQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: atlastin GTPase 1
• Database Link:
  NP_853629
  Entrez Gene 51062 Human
  UniProt ID Q8WXF7
• Background: The function of this protein remains unknown.
• Synonyms: AD-FSP; atlastin1; FSP1; GBP3; HSN1D; SPG3; SPG3A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Rabbit: 92%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane