TUBB2B Rabbit Polyclonal Antibody

CAT#: TA337744

Rabbit Polyclonal Anti-TUBB2B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TUBB2B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TUBB2B antibody is: synthetic peptide directed towards the N-terminal region of Human TUBB2B. Synthetic peptide located within the following region: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 50 kDa
Gene Name tubulin beta 2B class IIb
Background The protein encoded by this gene is a beta isoform of tubulin, which binds GTP and is a major component of microtubules. This gene is highly similar to TUBB2A and TUBB2C. Defects in this gene are a cause of asymmetric polymicrogyria.
Synonyms bA506K6.1; PMGYSA
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways Gap junction, Pathogenic Escherichia coli infection

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.