G6pc3 Rabbit Polyclonal Antibody

CAT#: TA337754

Rabbit Polyclonal Anti-G6pc3 Antibody

Product Images

Host: Rabbit; Target Name: G6pc3; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-G6pc3 antibody is: synthetic peptide directed towards the middle region of Mouse G6pc3. Synthetic peptide located within the following region: PEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNGQKIAC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: glucose 6 phosphatase, catalytic, 3
• Database Link:
  NP_787949
  Entrez Gene 68401 Mouse
  UniProt ID Q6NSQ9
• Background: G6pc3 hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It may form with the glucose-6-phosphate transporter (SLC37A4/G6PT) a ubiquitously expressed complex responsible for glucose production through glycogenolysis and gluconeogenesis. G6pc3 probably required for normal neutrophil function.
• Synonyms: G6Pase-beta; SCN4; UGRP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%