RAB39B Rabbit Polyclonal Antibody

CAT#: TA337808

Rabbit Polyclonal Anti-RAB39B Antibody

Product Images

WB Suggested Anti-RAB39B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB39B antibody: synthetic peptide directed towards the N terminal of human RAB39B. Synthetic peptide located within the following region: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: RAB39B, member RAS oncogene family
• Database Link:
  NP_741995
  Entrez Gene 116442 Human
  UniProt ID Q96DA2
• Background: RAB39B may be involved in vesicular trafficking.This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking.
• Synonyms: MRX72; WSMN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 92%

Reference Data

• Protein Families: Druggable Genome