NLRX1 Rabbit Polyclonal Antibody

CAT#: TA337810

Rabbit Polyclonal Anti-NLRX1 Antibody

Product Images

Sample Type : Lane 1: 35ug mouse neuroblastoma cells w/ empty vector Lane 2: 35ug mouse neuroblastoma cells w/ NLRX1 siRNA Primary Antibody Dilution : 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Color/Signal Descriptions

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRX1. Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 101 kDa
• Gene Name: NLR family member X1
• Database Link:
  NP_733840
  Entrez Gene 270151 Mouse
  UniProt ID Q86UT6
• Background: This gene encodes a member of the NLR family. Alternative splicing has been observed at this gene locus and two transcript variants, encoding distinct isoforms, have been identified.
• Synonyms: CLR11.3; DLNB26; NOD5; NOD9; NOD26
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Mouse: 86%; Dog: 79%; Pig: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Pathways: RIG-I-like receptor signaling pathway