NSP3 (SH2D3C) Rabbit Polyclonal Antibody

CAT#: TA337811

Rabbit Polyclonal Anti-SH2D3C Antibody

Product Images

WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: SH2D3C; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: SH2D3C; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: SH2D3C; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: SH2D3C; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SH2D3C antibody: synthetic peptide directed towards the N terminal of human SH2D3C. Synthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: SH2 domain containing 3C
• Database Link:
  NP_733745
  Entrez Gene 10044 Human
  UniProt ID Q8N5H7
• Background: SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.
• Synonyms: CHAT; NSP3; PRO34088; SHEP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome