IQCK Rabbit Polyclonal Antibody

CAT#: TA337854

Rabbit Polyclonal Anti-IQCK Antibody

Product Images

WB Suggested Anti-IQCK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: SH-SYSY cell lysate. There is BioGPS gene expression data showing that IQCK is expressed in SHSY5Y

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IQCK antibody: synthetic peptide directed towards the middle region of human IQCK. Synthetic peptide located within the following region: GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: IQ motif containing K
• Database Link:
  NP_694940
  Entrez Gene 124152 Human
  UniProt ID Q8N0W5
• Background: The specific function of this protein remains unknown.
• Synonyms: FLJ20115; FLJ36575; MGC35048
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%