Glypican 2 (GPC2) Rabbit Polyclonal Antibody

CAT#: TA337870

Rabbit Polyclonal Anti-GPC2 Antibody

Product Images

WB Suggested Anti-GPC2 Antibody; Titration: 1.0 ug/ml; Positive Control: HCT15 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPC2 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC2. Synthetic peptide located within the following region: GRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: glypican 2
• Database Link:
  NP_689955
  Entrez Gene 221914 Human
  UniProt ID Q8N158
• Background: GPC2 is a cell surface proteoglycan that bears heparan sulfate. GPC2 may fulfill a function related to the motile behaviors of developing neurons.
• Synonyms: DKFZp547M109; FLJ38962
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome