HGSNAT Rabbit Polyclonal Antibody

CAT#: TA337878

Rabbit Polyclonal Anti-HGSNAT Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "HGSNAT"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the C-terminal region of Human HGSNAT. Synthetic peptide located within the following region: VKGLWTGTPFFYPGMNSILVYVGHEVFENYFPFQWKLKDNQSHKEHLTQN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 2 kDa
Gene Name heparan-alpha-glucosaminide N-acetyltransferase
Background This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate.
Synonyms HGNAT; MPS3C; TMEM76
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.