Sphingosine 1 phosphate phosphatase 2 (SGPP2) Rabbit Polyclonal Antibody

CAT#: TA337880

Rabbit Polyclonal Anti-SGPP2 Antibody

Product Images

WB Suggested Anti-SGPP2 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SGPP2 antibody: synthetic peptide directed towards the C terminal of human SGPP2. Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: sphingosine-1-phosphate phosphatase 2
• Database Link:
  NP_689599
  Entrez Gene 130367 Human
  UniProt ID Q8IWX5
• Background: Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid metabolite that regulates diverse biologic processes. SGPP2 catalyzes the degradation of S1P (Ogawa et al., 2003 [PubMed 12411432]). [supplied by OMIM, Jun 2009]. ##Evidence-Data-START## Transcript exon combination :: BC134342.1, AF542512.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: SPP2; SPPase2
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Rat: 85%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Sphingolipid metabolism