ROR alpha (RORA) Rabbit Polyclonal Antibody
Other products for "RORA"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Rora antibody is synthetic peptide directed towards the middle region of Mouse Rora. Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 59 kDa |
| Gene Name | RAR related orphan receptor A |
| Database Link | |
| Background | Rora is an orphan nuclear receptor. It binds DNA as a monomer to hormone response elements (HRE) containing a single core motif half-site preceded by a short A-T-rich sequence. This isomer binds to the consensus sequence 5'-[AT][TA]A[AT][CGT]TAGGTCA-3'. Regulates a number of genes involved in lipid metabolism such as apolipoproteins AI, APOA5, CIII, CYP71 and PPARgamma, in cerebellum and photoreceptor development including PCP2, OPN1SW, OPN1SM AND ARR3, in circadian rhythm with BMAL1, and skeletal muscle development with MYOD1. IT is a possible receptor for cholesterol or one of its derivatives. |
| Synonyms | NR1F1; ROR1; ROR2; ROR3; RZR-ALPHA; RZRA |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93% |
| Reference Data | |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China