ROR alpha (RORA) Rabbit Polyclonal Antibody
Other products for "RORA"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 59 kDa |
| Gene Name | RAR related orphan receptor A |
| Database Link | |
| Background | The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014] |
| Synonyms | NR1F1; ROR1; ROR2; ROR3; RZR-ALPHA; RZRA |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100% |
| Reference Data | |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China