YTHDC1 Rabbit Polyclonal Antibody

CAT#: TA337926

Rabbit Polyclonal Anti-YTHDC1 Antibody

Product Images

WB Suggested Anti-YTHDC1 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-YTHDC1 antibody is: synthetic peptide directed towards the N-terminal region of Human YTHDC1. Synthetic peptide located within the following region: GKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: YTH domain containing 1
• Database Link:
  NP_588611
  Entrez Gene 91746 Human
  UniProt ID Q96MU7
• Background: YTHDC1 may be part of a signal transduction pathway that influences splice site selection.
• Synonyms: YT521; YT521-B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%; Yeast: 75%