LZTR2 (SEC16B) Rabbit Polyclonal Antibody

CAT#: TA337949

Rabbit Polyclonal Anti-SEC16B Antibody

Product Images

Host: Rabbit; Target Name: SEC16B; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEC16B antibody is: synthetic peptide directed towards the C-terminal region of Human SEC16B. Synthetic peptide located within the following region: KSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: SEC16 homolog B, endoplasmic reticulum export factor
• Database Link:
  NP_149118
  Entrez Gene 89866 Human
  UniProt ID Q96JE7
• Background: SEC16B is a mammalian homolog of S. cerevisiae Sec16 that is required for organization of transitional endoplasmic reticulum (ER) sites and protein export.
• Synonyms: LZTR2; PGPR-p117; RGPR; SEC16S
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 79%