PHF17 (JADE1) Rabbit Polyclonal Antibody

CAT#: TA337981

Rabbit Polyclonal Anti-PHF17 Antibody

Product Images

WB Suggested Anti-PHF17 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the C terminal of human PHF17. Synthetic peptide located within the following region: EPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: jade family PHD finger 1
• Database Link:
  NP_079176
  Entrez Gene 79960 Human
  UniProt ID Q6IE81
• Background: PHF17 belongs to the JADE family. It contains 2 PHD-type zinc fingers. PHF17 is a transcriptional coactivator which seems to act by promoting acetylation of nucleosomal histone H4 by HTATIP. PHF17 promotes apoptosis. Itmay act as a renal tumor suppressor.
• Synonyms: PHF17
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors