NLRX1 Rabbit Polyclonal Antibody

CAT#: TA337985

Rabbit Polyclonal Anti-NLRX1 Antibody

Product Images

Host: Rabbit; Target Name: NLRX1; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the C-terminal region of Human NLRX1. Synthetic peptide located within the following region: SEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 107 kDa
• Gene Name: NLR family member X1
• Database Link:
  NP_078894
  Entrez Gene 79671 Human
  UniProt ID Q86UT6
• Background: This gene encodes a member of the NLR family. Alternative splicing has been observed at this gene locus and two transcript variants, encoding distinct isoforms, have been identified.
• Synonyms: CLR11.3; DLNB26; NOD5; NOD9; NOD26
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 77%

Reference Data

• Protein Pathways: RIG-I-like receptor signaling pathway