NR1D1 Rabbit Polyclonal Antibody

CAT#: TA338008

Rabbit Polyclonal Anti-NR1D1 Antibody

Product Images

WB Suggested Anti-NR1D1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the middle region of human NR1D1. Synthetic peptide located within the following region: SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: nuclear receptor subfamily 1 group D member 1
• Database Link:
  NP_068370
  Entrez Gene 9572 Human
  UniProt ID P20393
• Background: This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein represses the circadian clock transcription factor aryl hydrocarbon receptor nuclear translocator-like protein 1 (ARNTL). This protein may also be involved in regulating genes that function in metabolic, inflammatory and cardiovascular processes. [provided by RefSeq, Jan 2013]
• Synonyms: ear-1; EAR1; hRev; THRA1; THRAL
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Rat: 92%; Sheep: 86%; Bovine: 86%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Circadian rhythm - mammal