DMTF1 Rabbit Polyclonal Antibody

CAT#: TA338013

Rabbit Polyclonal Anti-DMTF1 Antibody

Product Images

WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the middle region of human DMTF1. Synthetic peptide located within the following region: TFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: cyclin D binding myb like transcription factor 1
• Database Link:
  NP_066968
  Entrez Gene 23857 MouseEntrez Gene 9988 Human
  UniProt ID Q9Y222
• Background: DMTF1 is a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. DMTF1 is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of DMTF1 is regulated by binding of D-cyclins. The gene encoding DMTF1 is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer.
• Synonyms: DMP1; DMTF; hDMP1; MRUL
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%; Rat: 86%

Reference Data

• Protein Families: Transcription Factors