NDUFV3 Rabbit Polyclonal Antibody

CAT#: TA338015

Rabbit Polyclonal Anti-NDUFV3 Antibody

Product Images

WB Suggested Anti-NDUFV3 Antibody Titration: 5% Milk; ELISA Titer: dilution: 1: 500; Positive Control: Human LCL

• 

  WB Suggested Anti-NDUFV3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NDUFV3 antibody: synthetic peptide directed towards the middle region of human NDUFV3. Synthetic peptide located within the following region: PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: NADH:ubiquinone oxidoreductase subunit V3
• Database Link:
  NP_066553
  Entrez Gene 4731 Human
  UniProt ID P56181
• Background: The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: CI-9KD; CI-10k
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Mouse: 92%; Zebrafish: 92%; Rat: 86%

Reference Data

• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease