Repulsive Guidance Molecule A (RGMA) Rabbit Polyclonal Antibody

CAT#: TA338026

Rabbit Polyclonal Anti-Rgma Antibody

Product Images

Host: Rabbit; Target Name: Rgma; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rgma antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rgma. Synthetic peptide located within the following region: LPPAGDSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: repulsive guidance molecule family member a
• Database Link:
  NP_064596
  Entrez Gene 244058 Mouse
  UniProt ID Q96B86
• Background: The function of this protein remains unknown.
• Synonyms: RGM
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 92%; Dog: 86%