DSU (MREG) Rabbit Polyclonal Antibody

CAT#: TA338042

Rabbit Polyclonal Anti-MREG Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MREG"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MREG antibody is: synthetic peptide directed towards the C-terminal region of Human MREG. Synthetic peptide located within the following region: DSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name melanoregulin
Background MREG plays a role in the incorporation of pigments into hair. MREG may function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells.
Synonyms DSU; WDT2
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.