KIAA0652 (ATG13) Rabbit Polyclonal Antibody

CAT#: TA338082

Rabbit Polyclonal Anti-ATG13 Antibody

Product Images

WB Suggested Anti-ATG13 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell There is BioGPS gene expression data showing that ATG13 is expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATG13 antibody is: synthetic peptide directed towards the N-terminal region of Human ATG13. Synthetic peptide located within the following region: MCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: autophagy related 13
• Database Link:
  NP_055556
  Entrez Gene 9776 Human
  UniProt ID O75143
• Background: ATG13 is an autophagy factor required for autophagosome formation. ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
• Synonyms: KIAA0652; PARATARG8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%