SEC61A (SEC61A1) Rabbit Polyclonal Antibody

CAT#: TA338100

Rabbit Polyclonal Anti-SEC61A1 Antibody

Product Images

Host: Rabbit; Target Name: SEC61A1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: SEC61A1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-SEC61A1 Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole Cell SEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEC61A1 antibody is: synthetic peptide directed towards the C-terminal region of Human SEC61A1. Synthetic peptide located within the following region: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: Sec61 translocon alpha 1 subunit
• Database Link:
  NP_037468
  Entrez Gene 29927 Human
  UniProt ID P61619
• Background: The protein encoded by this gene belongs to the SECY/SEC61- alpha family. It appears to play a crucial role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. This protein found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins. This gene encodes an alpha subunit of the heteromeric SEC61 complex, which also contains beta and gamma subunits.
• Synonyms: HSEC61; SEC61; SEC61A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Vibrio cholerae infection