CTNNA3 Rabbit Polyclonal Antibody

CAT#: TA338101

Rabbit Polyclonal Anti-CTNNA3 Antibody

Product Images

Host: Rabbit; Target Name: CTNNA3; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTNNA3 antibody is: synthetic peptide directed towards the N-terminal region of Human CTNNA3. Synthetic peptide located within the following region: PLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: catenin alpha 3
• Database Link:
  NP_037398
  Entrez Gene 216033 Mouse
  UniProt ID Q9UI47
• Background: CTNNA3 may be involved in formation of stretch-resistant cell-cell adhesion complexes.
• Synonyms: ARVD13; VR22
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Pig: 85%; Zebrafish: 83%

Reference Data

• Protein Pathways: Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Endometrial cancer, Leukocyte transendothelial migration, Pathways in cancer, Tight junction