CDC42 Binding Protein Kinase Beta (CDC42BPB) Rabbit Polyclonal Antibody

CAT#: TA338137

Rabbit Polyclonal Anti-CDC42BPB Antibody

Product Images

WB Suggested Anti-CDC42BPB Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell CDC42BPB is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDC42BPB antibody is: synthetic peptide directed towards the C-terminal region of Human CDC42BPB. Synthetic peptide located within the following region: GLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPKPEASPSMSVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 194 kDa
• Gene Name: CDC42 binding protein kinase beta
• Database Link:
  NP_006026
  Entrez Gene 9578 Human
  UniProt ID Q9Y5S2
• Background: This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization.
• Synonyms: MRCKB
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Dog: 92%; Rabbit: 86%; Mouse: 83%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase