NTF2 (NUTF2) Rabbit Polyclonal Antibody

CAT#: TA338141

Rabbit Polyclonal Anti-NUTF2 Antibody

Product Images

WB Suggested Anti-NUTF2 Antibody; Titration: 1.0 ug/ml; Positive Control: ACHN Whole Cell NUTF2 is supported by BioGPS gene expression data to be expressed in ACHN

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUTF2 antibody is: synthetic peptide directed towards the middle region of Human NUTF2. Synthetic peptide located within the following region: KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: nuclear transport factor 2
• Database Link:
  NP_005787
  Entrez Gene 10204 Human
  UniProt ID P61970
• Background: The protein encoded by this gene is a cytosolic factor that facilitates protein transport into the nucleus. It interacts with the nuclear pore complex glycoprotein p62. This encoded protein acts at a relative late stage of nuclear protein import, subsequent to the initial docking of nuclear import ligand at the nuclear envelope. It is thought to be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.
• Synonyms: NTF-2; NTF2; PP15
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%