CDK2AP1 Rabbit Polyclonal Antibody

CAT#: TA338183

Rabbit Polyclonal Anti-CDK2AP1 Antibody

Product Images

WB Suggested Anti-CDK2AP1 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDK2AP1 antibody is: synthetic peptide directed towards the C-terminal region of Human CDK2AP1. Synthetic peptide located within the following region: LLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: cyclin-dependent kinase 2 associated protein 1
• Database Link:
  NP_004633
  Entrez Gene 8099 Human
  UniProt ID O14519
• Background: The protein encoded by this gene is a specific CDK2-associated protein, which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggested the regulatory role in DNA replication during S phase of the cell cycle. A similar gene in hamster was isolated from, and functions as a growth suppressor of normal keratinocytes.
• Synonyms: doc-1; DOC1; DORC1; p12DOC-1; ST19
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%