PSTPIP1 Rabbit Polyclonal Antibody

CAT#: TA338197

Rabbit Polyclonal Anti-PSTPIP1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PSTPIP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PSTPIP1 antibody is: synthetic peptide directed towards the N-terminal region of Human PSTPIP1. Synthetic peptide located within the following region: LLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSLKQQMENVGSSH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 43 kDa
Gene Name proline-serine-threonine phosphatase interacting protein 1
Background The protein encoded by this gene binds to the cytoplasmic tail of CD2, an effector of T cell activation and adhesion, negatively affecting CD2-triggered T cell activation. The encoded protein appears to be a scaffold protein and a regulator of the actin cytoskeleton. It has also been shown to bind ABL1, PTPN18, WAS, CD2AP, and PTPN12. Mutations in this gene are a cause of PAPA syndrome.
Synonyms CD2BP1; CD2BP1L; CD2BP1S; H-PIP; PAPAS; PSTPIP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.