Semaphorin 7a (SEMA7A) Rabbit Polyclonal Antibody

CAT#: TA338228

Rabbit Polyclonal Anti-SEMA7A Antibody

Product Images

WB Suggested Anti-SEMA7A Antibody; Titration: 1.0 ug/ml; Positive Control: MDA-MB-435S Whole Cell SEMA7A is supported by BioGPS gene expression data to be expressed in MDA-MB435

• 

  Host: Rabbit; Target Name: SEMA7A; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml SEMA7A is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEMA7A antibody is: synthetic peptide directed towards the C-terminal region of Human SEMA7A. Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: semaphorin 7A (John Milton Hagen blood group)
• Database Link:
  NP_003603
  Entrez Gene 8482 Human
  UniProt ID O75326
• Background: The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene.
• Synonyms: CD108; CDw108; H-SEMA-K1; H-Sema-L; JMH; SEMAK1; SEMAL
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 79%

Reference Data

• Protein Pathways: Axon guidance