NR2C2 Rabbit Polyclonal Antibody

CAT#: TA338235

Rabbit Polyclonal Anti-NR2C2 Antibody

Product Images

WB Suggested Anti-NR2C2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate.NR2C2 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2. Synthetic peptide located within the following region: INKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: nuclear receptor subfamily 2 group C member 2
• Database Link:
  NP_003289
  Entrez Gene 7182 Human
  UniProt ID P49116
• Background: This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014]
• Synonyms: TAK1; TR4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors