Tripeptidyl peptidase II (TPP2) Rabbit Polyclonal Antibody

CAT#: TA338236

Rabbit Polyclonal Anti-TPP2 Antibody

Product Images

WB Suggested Anti-TPP2 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell TPP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TPP2 antibody is: synthetic peptide directed towards the N-terminal region of Human TPP2. Synthetic peptide located within the following region: GAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 138 kDa
• Gene Name: tripeptidyl peptidase 2
• Database Link:
  NP_003282
  Entrez Gene 7174 Human
  UniProt ID P29144
• Background: This gene encodes a mammalian peptidase that, at neutral pH, removes tripeptides from the N terminus of longer peptides. The protein has a specialized function that is essential for some MHC class I antigen presentation. The protein is a high molecular mass serine exopeptidase; the amino acid sequence surrounding the serine residue at the active site is similar to the peptidases of the subtilisin class rather than the trypsin class.
• Synonyms: TPP-2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Protease