CPS1 Rabbit Polyclonal Antibody

CAT#: TA338263

Rabbit Polyclonal Anti-CPS1 Antibody

Product Images

WB Suggested Anti-CPS1 Antibody Titration: 5.0 ug/ml; Positive Control: Fetal liver cell lysate

• 

  Human Intestine

• 

  Sample Type: Pig duodenum Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP; Secondary Antibody: ilution: 1: 500; Color/Signal Descriptions: Brown: CPS; Gene Name: CPS1; Submitted by: Juan C. Mari, USDA/ARS Child

• 

  Sample Type: Pig ileum Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP; Secondary Antibody: ilution: 1: 500; Color/Signal Descriptions: Brown: CPS; Gene Name: CPS1; Submitted by: Juan C. Mari, USDA/ARS Children

• 

  Sample Type: Pig kidney Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP; Secondary Antibody: ilution: 1: 500; Color/Signal Descriptions: Brown: CPS; Gene Name: CPS1; Submitted by: Juan C. Mari, USDA/ARS Childre

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Pig
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 165 kDa
• Gene Name: carbamoyl-phosphate synthase 1
• Database Link:
  NP_001866
  Entrez Gene 1373 Human
  UniProt ID P31327
• Background: The mitochondrial enzyme encoded by this gene catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells. The encoded protein may also represent a core mitochondrial nucleoid protein. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. Mutations in this gene have been associated with carbamoyl phosphate synthetase deficiency, susceptibility to persistent pulmonary hypertension, and susceptibility to venoocclusive disease after bone marrow transplantation. [provided by RefSeq, May 2010]
• Synonyms: CPSASE1; PHN
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%; Yeast: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways, Nitrogen metabolism