DPAGT1 Rabbit Polyclonal Antibody

CAT#: TA338275

Rabbit Polyclonal Anti-DPAGT1 Antibody

Product Images

WB Suggested Anti-DPAGT1 Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell DPAGT1 is supported by BioGPS gene expression data to be expressed in PANC1

• 

  Host: Rabbit; Target Name: DPAGT1; Sample Tissue: Human HepG2; Antibody Dilution: 1.0 ug/ml DPAGT1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: DPAGT1; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml DPAGT1 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPAGT1 antibody is: synthetic peptide directed towards the C-terminal region of Human DPAGT1. Synthetic peptide located within the following region: TKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: dolichyl-phosphate N-acetylglucosaminephosphotransferase 1
• Database Link:
  NP_001373
  Entrez Gene 1798 Human
  UniProt ID Q9H3H5
• Background: The protein encoded by this gene is an enzyme that catalyzes the first step in the dolichol-linked oligosaccharide pathway for glycoprotein biosynthesis. This enzyme belongs to the glycosyltransferase family 4. This protein is an integral membrane protein of the endoplasmic reticulum. The congenital disorder of glycosylation type Ij is caused by mutation in the gene encoding this enzyme.
• Synonyms: ALG7; CDG-Ij; CDG1J; CMSTA2; D11S366; DGPT; DPAGT; DPAGT2; G1PT; GPT; UAGT; UGAT
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 86%; Pig: 79%; Horse: 79%; Mouse: 79%; Guinea pig: 79%; Rabbit: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis