Kininogen 1 (KNG1) Rabbit Polyclonal Antibody

CAT#: TA338316

Rabbit Polyclonal Anti-KNG1 Antibody

Product Images

WB Suggested Anti-KNG1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KNG1 antibody: synthetic peptide directed towards the middle region of human KNG1. Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: kininogen 1
• Database Link:
  NP_001095886
  Entrez Gene 3827 Human
  UniProt ID P01042
• Background: This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
• Synonyms: BDK; BK; KNG
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 85%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Complement and coagulation cascades