ENGASE Rabbit Polyclonal Antibody

CAT#: TA338329

Rabbit Polyclonal Anti-ENGASE Antibody

Product Images

Host: Rabbit; Target Name: ENGASE; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ENGASE antibody is: synthetic peptide directed towards the N-terminal region of Human ENGASE. Synthetic peptide located within the following region: RRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: endo-beta-N-acetylglucosaminidase
• Database Link:
  NP_001036038
  Entrez Gene 64772 Human
  UniProt ID Q8NFI3
• Background: This gene encodes a cytosolic enzyme which catalyzes the hydrolysis of peptides and proteins with mannose modifications to produce free oligosaccharides.
• Synonyms: DKFZp434P174; FLJ21865
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Pathways: Other glycan degradation