Plasma Kallikrein 1B (KLKB1) Rabbit Polyclonal Antibody

CAT#: TA338358

Rabbit Polyclonal Anti-KLKB1 Antibody

Product Images

WB Suggested Anti-KLKB1 Antibody Titration: 2.5 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLKB1 antibody: synthetic peptide directed towards the middle region of human KLKB1. Synthetic peptide located within the following region: VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: kallikrein B1
• Database Link:
  NP_000883
  Entrez Gene 3818 Human
  UniProt ID P03952
• Background: Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma kallikrein therefore is composed of a heavy chain and a light chain held together by a disulphide bond. The heavy chain originates from the amino-terminal end of the zymogen and contains 4 tandem repeats of 90 or 91 amino acids. Each repeat harbors a novel structure called the apple domain. The heavy chain is required for the surface-dependent pro-coagulant activity of plasma kallikrein. The light chain contains the active site or catalytic domain of the enzyme and is homologous to the trypsin family of serine proteases. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients. [provided by RefSeq, Jul 2008]
• Synonyms: KLK3; PPK
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86%; Pig: 79%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Complement and coagulation cascades