Plasma Kallikrein 1B (KLKB1) Rabbit Polyclonal Antibody
Other products for "KLKB1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Rat |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Klkb1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 69 kDa |
| Gene Name | kallikrein B1 |
| Database Link | |
| Background | serine protease that plays a role in blood coagulation [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC089815.1, M30282.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369731, SRS369740 [ECO:0000348] ##Evidence-Data-END## |
| Synonyms | KLK3; PPK |
| Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Guinea pig: 86%; Mouse: 79% |
| Reference Data | |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Complement and coagulation cascades |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China