Plasma Kallikrein 1B (KLKB1) Rabbit Polyclonal Antibody

CAT#: TA338359

Rabbit Polyclonal Anti-Klkb1 Antibody

Product Images

WB Suggested Anti-Klkb1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Klkb1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: kallikrein B1
• Database Link:
  NP_000883
  Entrez Gene 25048 Rat
  UniProt ID P03952
• Background: serine protease that plays a role in blood coagulation [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC089815.1, M30282.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369731, SRS369740 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: KLK3; PPK
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Complement and coagulation cascades