Chloride Channel 5 (CLCN5) Rabbit Polyclonal Antibody

CAT#: TA338390

Rabbit Polyclonal Anti-Clcn5 Antibody

Product Images

WB Suggested Anti-Clcn5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Mouse Brain

• 

  Host: Rabbit; Target Name: Clcn5; Sample Tissue: Rat Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: Clcn5; Sample Tissue: Rat Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: Clcn5; Sample Tissue: Mouse Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: Clcn5; Sample Tissue: Rat Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: Clcn5; Sample Tissue: Mouse Spleen; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: Clcn5; Sample Tissue: Mouse Liver; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: Clcn5; Sample Tissue: Mouse Kidney; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: Clcn5; Sample Tissue: Rat Muscle; Antibody Dilution: 1.0 ug/ml

Show all 9 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Clcn5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: chloride voltage-gated channel 5
• Database Link:
  NP_000075
  Entrez Gene 12728 MouseEntrez Gene 25749 Rat
  UniProt ID P51795
• Background: Proton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons. Important for normal acidification of the endosome lumen. May play an important role in renal tubular function.
• Synonyms: ClC-5; CLC5; CLCK2; DENTS; hCIC-K2; NPHL1; NPHL2; XLRH; XRN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane