CLCN1 Rabbit Polyclonal Antibody

CAT#: TA338391

Rabbit Polyclonal Anti-Clcn1 Antibody

Product Images

WB Suggested Anti-Clcn1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Rat Brain

• 

  Lanes: 1: 20ug mouse muscle membrane fraction, 2: Empty, 3: 20ug mouse brain membrane fraction, 4: Empty, 5: 20ug mouse muscle cytosolic fraction, 6: 20ug mouse brain cytosolic fraction; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Anti-rabb

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Gene Name: chloride voltage-gated channel 1
• Database Link:
  NP_000074
  Entrez Gene 12723 MouseEntrez Gene 25688 Rat
  UniProt ID P35523
• Background: plays a role in chloride ion transport and membrane conductance in skeletal muscle [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: X62894.1, AY112740.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369733, SRS369742 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: CLC1
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Goat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane