TMEM63C Rabbit Polyclonal Antibody

CAT#: TA338418

Rabbit Polyclonal Anti-TMEM63C Antibody

Product Images

WB Suggested Anti-TMEM63C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM63C antibody: synthetic peptide directed towards the middle region of human TMEM63C. Synthetic peptide located within the following region: EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: transmembrane protein 63C
• Database Link:
  NP_065164
  Entrez Gene 57156 Human
  UniProt ID Q9P1W3
• Background: The specific function of the protein remains unknown.
• Synonyms: C14orf171; CSC1; hsCSC1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 92%; Dog: 86%

Reference Data

• Protein Families: Transmembrane