DOLPP1 Rabbit Polyclonal Antibody

CAT#: TA338419

Rabbit Polyclonal Anti-DOLPP1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DOLPP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DOLPP1 antibody: synthetic peptide directed towards the N terminal of human DOLPP1. Synthetic peptide located within the following region: AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name dolichyldiphosphatase 1
Background DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.
Synonyms LSFR2
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways N-Glycan biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.