Nceh1 Rabbit Polyclonal Antibody

CAT#: TA338440

Rabbit Polyclonal Anti-Nceh1 Antibody

Product Images

WB Suggested Anti-Nceh1Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Nceh1antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: neutral cholesterol ester hydrolase 1
• Database Link:
  NP_848887
  Entrez Gene 57552 HumanEntrez Gene 320024 Mouse
  UniProt ID Q8BLF1
• Background: Nceh1is hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. It may be responsible for cholesterol ester hydrolysis in macrophages. It also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds.
• Synonyms: AADACL1; NCEH
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%