SEMA6A Rabbit Polyclonal Antibody

CAT#: TA338441

Rabbit Polyclonal Anti-SEMA6A Antibody

Product Images

WB Suggested Anti-SEMA6A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysate SEMA6A is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEMA6A antibody: synthetic peptide directed towards the middle region of human SEMA6A. Synthetic peptide located within the following region: ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 114 kDa
• Gene Name: semaphorin 6A
• Database Link:
  NP_065847
  Entrez Gene 57556 Human
  UniProt ID Q9H2E6
• Background: SEMA6A can act as repulsive axon guidance cues. SEMA6A may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.
• Synonyms: HT018; SEMA; SEMA6A1; SEMAQ; VIA
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Axon guidance